SCOPe 2.05: Domain d3heea_: 3hee A:

Lineage for d3heea_ (3hee A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.121: Ribose/Galactose isomerase RpiB/AlsB [89622] (1 superfamily)
   3 layers: a/b/a, core: parallel beta-sheet of 5 strands, order 21354; topological similarity to a part of the arginase/deacetylase fold

4. Superfamily c.121.1: Ribose/Galactose isomerase RpiB/AlsB [89623] (2 families)

5. Family c.121.1.1: Ribose/Galactose isomerase RpiB/AlsB [89624] (3 proteins)
   automatically mapped to Pfam PF02502

6. Protein automated matches [191284] (1 species)
   not a true protein

7. Species Clostridium thermocellum [TaxId:203119] [189908] (4 PDB entries)

8. Domain d3heea_: 3hee A: [199510]
   automated match to d3he8b_
   complexed with r5p

Details for d3heea_

PDB Entry: 3hee, 2 Å

PDB Description: Structural study of Clostridium thermocellum Ribose-5-Phosphate Isomerase B and ribose-5-phosphate

PDB Compounds: (A:) Ribose-5-phosphate isomerase

SCOPe Domain Sequences for d3heea_:

Sequence; same for both SEQRES and ATOM records:

>d3heea_ c.121.1.1 (A:) automated matches {Clostridium thermocellum [TaxId: 203119]}
mkigigsdhggynlkreiadflkkrgyevidfgthgnesvdypdfglkvaeavksgecdr
givicgtglgisiaankvpgiraavctnsymarmsrehndanilalgervvgldlaldiv
dtwlkaefqggrhatrvgkigeiekkys

Timeline for d3heea_:

• d3heea_ first appeared in SCOPe 2.03
  
• d3heea_ appears in SCOPe 2.04
  
• d3heea_ appears in SCOPe 2.06
  
• d3heea_ appears in the current release, SCOPe 2.08