SCOPe 2.07: Domain d3he7c2: 3he7 C:118-207

Lineage for d3he7c2 (3he7 C:118-207)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (17 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (654 PDB entries)

8. Domain d3he7c2: 3he7 C:118-207 [199506]
   Other proteins in same PDB: d3he7a1, d3he7a2, d3he7a3, d3he7b_, d3he7c1, d3he7d1, d3he7d2
   automated match to d1qrnd2
   complexed with agh, nag

Details for d3he7c2

PDB Entry: 3he7, 2.8 Å

PDB Description: crystal structure of mouse cd1d-alpha-galactosylceramide with mouse valpha14-vbeta7 nkt tcr

PDB Compounds: (C:) Valpha14(mouse variable domain, human constant domain)

SCOPe Domain Sequences for d3he7c2:

Sequence, based on SEQRES records:

>d3he7c2 b.1.1.2 (C:118-207) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffpsp

Sequence, based on observed residues (ATOM records):

>d3he7c2 b.1.1.2 (C:118-207) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
iqnpdpavyqlrdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavaws
nksacanafnnsiipedtffpsp

Timeline for d3he7c2:

• d3he7c2 first appeared in SCOPe 2.03
  
• d3he7c2 appears in SCOPe 2.06
  
• d3he7c2 appears in the current release, SCOPe 2.08