SCOPe 2.08: Domain d3he6d2: 3he6 D:119-247

Lineage for d3he6d2 (3he6 D:119-247)

Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein automated matches [190374] (15 species)
not a true protein
Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)
Domain d3he6d2: 3he6 D:119-247 [199502]
Other proteins in same PDB: d3he6a1, d3he6a2, d3he6a3, d3he6b_, d3he6c1, d3he6d1
automated match to d1ktke2
complexed with agh, nag

Details for d3he6d2

PDB Entry: 3he6 (more details), 2.9 Å

PDB Description: crystal structure of mouse cd1d-alpha-galactosylceramide with mouse valpha14-vbeta8.2 nkt tcr

PDB Compounds: (D:) Vbeta8.2(mouse variable domain, human constant domain)

SCOPe Domain Sequences for d3he6d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3he6d2 b.1.1.2 (D:119-247) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgrad

SCOPe Domain Coordinates for d3he6d2:

Click to download the PDB-style file with coordinates for d3he6d2.
(The format of our PDB-style files is described here.)

Timeline for d3he6d2: