Lineage for d3he6d1 (3he6 D:3-118)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1295808Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1295809Protein automated matches [190740] (23 species)
    not a true protein
  7. 1296776Species Mouse (Mus musculus) [TaxId:10090] [188198] (246 PDB entries)
  8. 1297187Domain d3he6d1: 3he6 D:3-118 [199501]
    Other proteins in same PDB: d3he6a1, d3he6b_, d3he6c2, d3he6d2
    automated match to d1ktke1
    complexed with agh, nag

Details for d3he6d1

PDB Entry: 3he6 (more details), 2.9 Å

PDB Description: crystal structure of mouse cd1d-alpha-galactosylceramide with mouse valpha14-vbeta8.2 nkt tcr
PDB Compounds: (D:) Vbeta8.2(mouse variable domain, human constant domain)

SCOPe Domain Sequences for d3he6d1:

Sequence, based on SEQRES records: (download)

>d3he6d1 b.1.1.0 (D:3-118) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
avtqsprnkvavtggkvtlscnqtnnhnnmywyrqdtghglrlihysygagstekgdipd
gykasrpsqenfslilelatpsqtsvyfcasgdaggnyaeqffgpgtrltvle

Sequence, based on observed residues (ATOM records): (download)

>d3he6d1 b.1.1.0 (D:3-118) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
avtqsprnkvavtggkvtlscnqtnnhnnmywyrqdtghglrlihysygagstekgdipd
gykasrpsqenfslilelatpsqtsvyfcasgdaqffgpgtrltvle

SCOPe Domain Coordinates for d3he6d1:

Click to download the PDB-style file with coordinates for d3he6d1.
(The format of our PDB-style files is described here.)

Timeline for d3he6d1: