Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (23 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [188198] (246 PDB entries) |
Domain d3he6d1: 3he6 D:3-118 [199501] Other proteins in same PDB: d3he6a1, d3he6b_, d3he6c2, d3he6d2 automated match to d1ktke1 complexed with agh, nag |
PDB Entry: 3he6 (more details), 2.9 Å
SCOPe Domain Sequences for d3he6d1:
Sequence, based on SEQRES records: (download)
>d3he6d1 b.1.1.0 (D:3-118) automated matches {Mouse (Mus musculus) [TaxId: 10090]} avtqsprnkvavtggkvtlscnqtnnhnnmywyrqdtghglrlihysygagstekgdipd gykasrpsqenfslilelatpsqtsvyfcasgdaggnyaeqffgpgtrltvle
>d3he6d1 b.1.1.0 (D:3-118) automated matches {Mouse (Mus musculus) [TaxId: 10090]} avtqsprnkvavtggkvtlscnqtnnhnnmywyrqdtghglrlihysygagstekgdipd gykasrpsqenfslilelatpsqtsvyfcasgdaqffgpgtrltvle
Timeline for d3he6d1: