| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein automated matches [190374] (15 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries) |
| Domain d3he6c2: 3he6 C:118-208 [199500] Other proteins in same PDB: d3he6a1, d3he6a2, d3he6a3, d3he6b_, d3he6c1, d3he6d1 automated match to d1qrnd2 complexed with agh, nag |
PDB Entry: 3he6 (more details), 2.9 Å
SCOPe Domain Sequences for d3he6c2:
Sequence, based on SEQRES records: (download)
>d3he6c2 b.1.1.2 (C:118-208) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffpspe
>d3he6c2 b.1.1.2 (C:118-208) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
iqnpdpavyqlrdsksksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsav
awsnksdfacanafnnsiipedtffpspe
Timeline for d3he6c2: