Lineage for d1a7pl_ (1a7p L:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) 
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins) Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species) 
Species Fab D1.3 (mouse), kappa L chain [48784] (19 PDB entries) 
Domain d1a7pl_: 1a7p L: [19950]
Details for d1a7pl_
PDB Entry: 1a7p (more details), 2 Å
PDB Description: fv fragment of mouse monoclonal antibody d1.3 (balb/c, igg1, k) engineered mutant pro95l->ser on variant chain l glu81->asp and chain h leu312->val
SCOP Domain Sequences for d1a7pl_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a7pl_ b.1.1.1 (L:) Immunoglobulin (variable domains of L and H chains) {Fab D1.3 (mouse), kappa L chain}
divltqspaslsasvgetvtitcrasgnihnylawyqqkqgkspqllvyytttladgvps
rfsgsgsgtqyslkinslqpddfgsyycqhfwstsrtfgggtkleik
SCOP Domain Coordinates for d1a7pl_:
Click to download the PDB-style file with coordinates for d1a7pl_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1a7pl_:
- d1a7pl_ appears in SCOP 1.57
- d1a7pl_ appears in the current release, SCOPe 2.08
View in 3D
