Class b: All beta proteins [48724] (93 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species) |
Species Fab D1.3 (mouse), kappa L chain [48784] (19 PDB entries) |
Domain d1a7pl_: 1a7p L: [19950] |
PDB Entry: 1a7p (more details), 2 Å
SCOP Domain Sequences for d1a7pl_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a7pl_ b.1.1.1 (L:) Immunoglobulin (variable domains of L and H chains) {Fab D1.3 (mouse), kappa L chain} divltqspaslsasvgetvtitcrasgnihnylawyqqkqgkspqllvyytttladgvps rfsgsgsgtqyslkinslqpddfgsyycqhfwstsrtfgggtkleik
Timeline for d1a7pl_: