Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.0: automated matches [227140] (1 protein) not a true family |
Protein automated matches [226842] (4 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [224924] (33 PDB entries) |
Domain d3he6a1: 3he6 A:8-185 [199497] Other proteins in same PDB: d3he6a2, d3he6a3, d3he6b_, d3he6c1, d3he6c2, d3he6d1, d3he6d2 automated match to d1gzpa2 complexed with agh, nag |
PDB Entry: 3he6 (more details), 2.9 Å
SCOPe Domain Sequences for d3he6a1:
Sequence, based on SEQRES records: (download)
>d3he6a1 d.19.1.0 (A:8-185) automated matches {Mouse (Mus musculus) [TaxId: 10090]} ytfrclqmssfanrswsrtdsvvwlgdlqthrwsndsatisftkpwsqgklsnqqweklq hmfqvyrvsftrdiqelvkmmspkedypieiqlsagcemypgnasesflhvafqgkyvvr fwgtswqtvpgapswldlpikvlnadqgtsatvqmllndtcplfvrglleagksdlek
>d3he6a1 d.19.1.0 (A:8-185) automated matches {Mouse (Mus musculus) [TaxId: 10090]} ytfrclqmssfanrswsrtdsvvwlgdlqthrwsndsatisftkpwsqgklsnqqweklq hmfqvyrvsftrdiqelvkmmsypieiqlsagcemypgasesflhvafqgkyvvrfwgts wqtvpgapswldlpikvlnadqgtsatvqmllndtcplfvrglleagksdlek
Timeline for d3he6a1: