Lineage for d3he6a1 (3he6 A:8-185)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2938649Family d.19.1.0: automated matches [227140] (1 protein)
    not a true family
  6. 2938650Protein automated matches [226842] (5 species)
    not a true protein
  7. 2938889Species Mouse (Mus musculus) [TaxId:10090] [224924] (70 PDB entries)
  8. 2938962Domain d3he6a1: 3he6 A:8-185 [199497]
    Other proteins in same PDB: d3he6a2, d3he6a3, d3he6b_, d3he6c1, d3he6c2, d3he6d1, d3he6d2
    automated match to d1gzpa2
    complexed with agh, nag

Details for d3he6a1

PDB Entry: 3he6 (more details), 2.9 Å

PDB Description: crystal structure of mouse cd1d-alpha-galactosylceramide with mouse valpha14-vbeta8.2 nkt tcr
PDB Compounds: (A:) Antigen-presenting glycoprotein CD1d1

SCOPe Domain Sequences for d3he6a1:

Sequence, based on SEQRES records: (download)

>d3he6a1 d.19.1.0 (A:8-185) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ytfrclqmssfanrswsrtdsvvwlgdlqthrwsndsatisftkpwsqgklsnqqweklq
hmfqvyrvsftrdiqelvkmmspkedypieiqlsagcemypgnasesflhvafqgkyvvr
fwgtswqtvpgapswldlpikvlnadqgtsatvqmllndtcplfvrglleagksdlek

Sequence, based on observed residues (ATOM records): (download)

>d3he6a1 d.19.1.0 (A:8-185) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ytfrclqmssfanrswsrtdsvvwlgdlqthrwsndsatisftkpwsqgklsnqqweklq
hmfqvyrvsftrdiqelvkmmsypieiqlsagcemypgasesflhvafqgkyvvrfwgts
wqtvpgapswldlpikvlnadqgtsatvqmllndtcplfvrglleagksdlek

SCOPe Domain Coordinates for d3he6a1:

Click to download the PDB-style file with coordinates for d3he6a1.
(The format of our PDB-style files is described here.)

Timeline for d3he6a1: