Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
Protein automated matches [190056] (165 species) not a true protein |
Species Bordetella parapertussis [TaxId:519] [196569] (1 PDB entry) |
Domain d3hd5b1: 3hd5 B:31-208 [199496] Other proteins in same PDB: d3hd5a2, d3hd5b2, d3hd5c2 automated match to d3hd5c_ |
PDB Entry: 3hd5 (more details), 2.35 Å
SCOPe Domain Sequences for d3hd5b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hd5b1 c.47.1.0 (B:31-208) automated matches {Bordetella parapertussis [TaxId: 519]} qqyvninppmpsdtpgkievleffaytcphcaaiepmvedwaktapqdvvlkqvpiafna gmkplqqlyytlqalerpdlhpkvftaihterkrlfdkkamgewaasqgvdrakfdsvfd sfsvqtqvqrasqlaeaahidgtpafavggrymtspvlagndyagalkvvdqlivqsr
Timeline for d3hd5b1:
View in 3D Domains from other chains: (mouse over for more information) d3hd5a1, d3hd5a2, d3hd5c1, d3hd5c2 |