Lineage for d3hd5a_ (3hd5 A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1852416Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1852417Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1854430Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 1854431Protein automated matches [190056] (147 species)
    not a true protein
  7. 1854683Species Bordetella parapertussis [TaxId:519] [196569] (1 PDB entry)
  8. 1854684Domain d3hd5a_: 3hd5 A: [199495]
    automated match to d3hd5c_

Details for d3hd5a_

PDB Entry: 3hd5 (more details), 2.35 Å

PDB Description: crystal structure of a thiol:disulfide interchange protein dsba from bordetella parapertussis
PDB Compounds: (A:) Thiol:disulfide interchange protein dsbA

SCOPe Domain Sequences for d3hd5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hd5a_ c.47.1.0 (A:) automated matches {Bordetella parapertussis [TaxId: 519]}
qgaqqyvninppmpsdtpgkievleffaytcphcaaiepmvedwaktapqdvvlkqvpia
fnagmkplqqlyytlqalerpdlhpkvftaihterkrlfdkkamgewaasqgvdrakfds
vfdsfsvqtqvqrasqlaeaahidgtpafavggrymtspvlagndyagalkvvdqlivqs
re

SCOPe Domain Coordinates for d3hd5a_:

Click to download the PDB-style file with coordinates for d3hd5a_.
(The format of our PDB-style files is described here.)

Timeline for d3hd5a_: