![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
![]() | Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
![]() | Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (3 proteins) |
![]() | Protein Cytochrome c oxidase [49544] (4 species) |
![]() | Species Paracoccus denitrificans [TaxId:266] [49546] (4 PDB entries) |
![]() | Domain d3hb3b2: 3hb3 B:108-252 [199494] Other proteins in same PDB: d3hb3a_, d3hb3b1, d3hb3c_, d3hb3d_ automated match to d1ar1b1 complexed with ca, cu1, hea, lda, lmt, mn, peo |
PDB Entry: 3hb3 (more details), 2.25 Å
SCOPe Domain Sequences for d3hb3b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hb3b2 b.6.1.2 (B:108-252) Cytochrome c oxidase {Paracoccus denitrificans [TaxId: 266]} ndpdlvikaighqwywsyeypndgvafdalmlekealadagysedeyllatdnpvvvpvg kkvlvqvtatdvihawtipafavkqdavpgriaqlwfsvdqegvyfgqcselcginhaym pivvkavsqekyeawlagakeefaa
Timeline for d3hb3b2: