Lineage for d3h2va_ (3h2v A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1988268Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 1988762Superfamily a.24.9: alpha-catenin/vinculin-like [47220] (2 families) (S)
  5. 1988763Family a.24.9.1: alpha-catenin/vinculin [47221] (3 proteins)
    possible duplication: contains several domains of this fold
    The listed PDB entries contain different large fragments but not the whole proteins
  6. 1988827Protein automated matches [226863] (2 species)
    not a true protein
  7. 1988835Species Human (Homo sapiens) [TaxId:9606] [224995] (5 PDB entries)
  8. 1988845Domain d3h2va_: 3h2v A: [199488]
    Other proteins in same PDB: d3h2ve1, d3h2ve2, d3h2vf1, d3h2vf2, d3h2vg1, d3h2vg2, d3h2vh1, d3h2vh2
    automated match to d1qkrb_
    protein/RNA complex

Details for d3h2va_

PDB Entry: 3h2v (more details), 2.9 Å

PDB Description: Human raver1 RRM1 domain in complex with human vinculin tail domain Vt
PDB Compounds: (A:) vinculin

SCOPe Domain Sequences for d3h2va_:

Sequence, based on SEQRES records: (download)

>d3h2va_ a.24.9.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
efpeqkagevinqpmmmaarqlhdearkwsskgndiiaaakrmallmaemsrlvrggsgt
kraliqcakdiakasdevtrlakevakqctdkrirtnllqvceriptistqlkilstvka
tmlgrtnisdeeseqatemlvhnaqnlmqsvketvreaeaasikirtdagftlrwvrk

Sequence, based on observed residues (ATOM records): (download)

>d3h2va_ a.24.9.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
efpeqvinqpmmmaarqlhdearkwsskgndiiaaakrmallmaemsrlvrggsgtkral
iqcakdiakasdevtrlakevakqctdkrirtnllqvceriptistqlkilstvkatmlg
rtnisdeeseqatemlvhnaqnlmqsvketvreaeaasikirtdagftlrwvrk

SCOPe Domain Coordinates for d3h2va_:

Click to download the PDB-style file with coordinates for d3h2va_.
(The format of our PDB-style files is described here.)

Timeline for d3h2va_: