SCOPe 2.08: Domain d3h05a_: 3h05 A:

Lineage for d3h05a_ (3h05 A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families)

5. Family c.26.1.0: automated matches [191377] (1 protein)
   not a true family

6. Protein automated matches [190459] (61 species)
   not a true protein

7. Species Vibrio parahaemolyticus [TaxId:670] [196584] (1 PDB entry)

8. Domain d3h05a_: 3h05 A: [199482]
   automated match to d3h05b_
   complexed with cl

Details for d3h05a_

PDB Entry: 3h05, 1.65 Å

PDB Description: the crystal structure of a putative nicotinate-nucleotide adenylyltransferase from vibrio parahaemolyticus

PDB Compounds: (A:) uncharacterized protein VPA0413

SCOPe Domain Sequences for d3h05a_:

Sequence, based on SEQRES records:

>d3h05a_ c.26.1.0 (A:) automated matches {Vibrio parahaemolyticus [TaxId: 670]}
mkkiaifgsafnppslghksvieslshfdlvllepsiahawgknmldypircklvdafik
dmglsnvqrsdleqalyqpgqsvttyallekiqeiyptaditfvigpdnffkfakfykae
eiterwtvmacpekvkirstdirnaliegkdistyttptvsellln

Sequence, based on observed residues (ATOM records):

>d3h05a_ c.26.1.0 (A:) automated matches {Vibrio parahaemolyticus [TaxId: 670]}
mkkiaifgsafnppslghksvieslshfdlvllepsimldypircklvdafikdmglsnv
qrsdleqalysvttyallekiqeiyptaditfvigpdnffkfakfykaeeiterwtvmac
pekvkirstdirnaliegkdistyttptvsellln

Timeline for d3h05a_:

• d3h05a_ first appeared in SCOPe 2.03
  
• d3h05a_ appears in SCOPe 2.07