Lineage for d1g7ha_ (1g7h A:)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 218899Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)
  6. 218958Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)
  7. 219646Species Fab D1.3 (mouse), kappa L chain [48784] (19 PDB entries)
  8. 219665Domain d1g7ha_: 1g7h A: [19948]
    Other proteins in same PDB: d1g7hc_

Details for d1g7ha_

PDB Entry: 1g7h (more details), 1.85 Å

PDB Description: crystal structure of hen egg white lysozyme (hel) complexed with the mutant anti-hel monoclonal antibody d1.3(vlw92a)

SCOP Domain Sequences for d1g7ha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g7ha_ b.1.1.1 (A:) Immunoglobulin (variable domains of L and H chains) {Fab D1.3 (mouse), kappa L chain}
divltqspaslsasvgetvtitcrasgnihnylawyqqkqgkspqllvyytttladgvps
rfsgsgsgtqyslkinslqpedfgsyycqhfastprtfgggtkleik

SCOP Domain Coordinates for d1g7ha_:

Click to download the PDB-style file with coordinates for d1g7ha_.
(The format of our PDB-style files is described here.)

Timeline for d1g7ha_: