Lineage for d3gw9a_ (3gw9 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2005528Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2005529Protein automated matches [190847] (63 species)
    not a true protein
  7. 2006000Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [194968] (7 PDB entries)
  8. 2006001Domain d3gw9a_: 3gw9 A: [199474]
    automated match to d3gw9d_
    complexed with hem, vni

Details for d3gw9a_

PDB Entry: 3gw9 (more details), 1.87 Å

PDB Description: Crystal structure of sterol 14-alpha demethylase (CYP51) from Trypanosoma brucei bound to an inhibitor N-(1-(2,4-dichlorophenyl)-2-(1H-imidazol-1-yl)ethyl)-4-(5-phenyl-1,3,4-oxaziazol-2-yl)benzamide
PDB Compounds: (A:) sterol 14alpha-demethylase

SCOPe Domain Sequences for d3gw9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gw9a_ a.104.1.0 (A:) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
kgklppvypvtvpilghiiqfgksplgfmqeckrqlksgiftinivgkrvtivgdphehs
rfflprnevlsprevysfmvpvfgegvayaapyprmreqlnflaeeltiakfqnfvpaiq
hevrkfmaanwdkdegeinlledcstmiintacqclfgedlrkrldarrfaqllakmess
lipaavflpillklplpqsarcheartelqkilseiiiarkeeevnkdsstsdllsglls
avyrdgtpmslhevcgmivaamfagqhtssitttwsmlhlmhpanvkhlealrkeieefp
aqlnynnvmdempfaercaresirrdppllmlmrkvmadvkvgsyvvpkgdiiacsplls
hhdeeafpeprrwdperdekvegafigfgagvhkcigqkfgllqvktilatafrsydfql
lrdevpdpdyhtmvvgptasqcrvkyirrk

SCOPe Domain Coordinates for d3gw9a_:

Click to download the PDB-style file with coordinates for d3gw9a_.
(The format of our PDB-style files is described here.)

Timeline for d3gw9a_: