SCOPe 2.03: Domain d3guyc_: 3guy C:

Lineage for d3guyc_ (3guy C:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (159 species)
   not a true protein

7. Species Vibrio parahaemolyticus [TaxId:419109] [196586] (1 PDB entry)

8. Domain d3guyc_: 3guy C: [199469]
   automated match to d3guyh_

Details for d3guyc_

PDB Entry: 3guy, 1.9 Å

PDB Description: crystal structure of a short-chain dehydrogenase/reductase from vibrio parahaemolyticus

PDB Compounds: (C:) Short-chain dehydrogenase/reductase SDR

SCOPe Domain Sequences for d3guyc_:

Sequence, based on SEQRES records:

>d3guyc_ c.2.1.0 (C:) automated matches {Vibrio parahaemolyticus [TaxId: 419109]}
livitgassglgaelaklydaegkatyltgrsesklstvtnclsnnvgyrardlashqev
eqlfeqldsipstvvhsagsgyfgllqeqdpeqiqtliennlssainvlrelvkrykdqp
vnvvmimstaaqqpkaqestycavkwavkgliesvrlelkgkpmkiiavypggmatefwe
tsgksldtssfmsaedaalmihgalanigngyvsditvnre

Sequence, based on observed residues (ATOM records):

>d3guyc_ c.2.1.0 (C:) automated matches {Vibrio parahaemolyticus [TaxId: 419109]}
livitgassglgaelaklydaegkatyltgrsesklstvtnclsnnvgyrardlashqev
eqlfeqldsipstvvhsagsgyfgllqeqdpeqiqtliennlssainvlrelvkrykdqp
vnvvmimstaaqqpkaqestycavkwavkgliesvrlelkgkpmkiiavypggmatefws
sfmsaedaalmihgalanigngyvsditvnre

Timeline for d3guyc_:

• d3guyc_ is new in SCOPe 2.03-stable
  
• d3guyc_ appears in SCOPe 2.04
  
• d3guyc_ appears in the current release, SCOPe 2.08, called d3guyc1