Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (159 species) not a true protein |
Species Vibrio parahaemolyticus [TaxId:419109] [196586] (1 PDB entry) |
Domain d3guyc_: 3guy C: [199469] automated match to d3guyh_ |
PDB Entry: 3guy (more details), 1.9 Å
SCOPe Domain Sequences for d3guyc_:
Sequence, based on SEQRES records: (download)
>d3guyc_ c.2.1.0 (C:) automated matches {Vibrio parahaemolyticus [TaxId: 419109]} livitgassglgaelaklydaegkatyltgrsesklstvtnclsnnvgyrardlashqev eqlfeqldsipstvvhsagsgyfgllqeqdpeqiqtliennlssainvlrelvkrykdqp vnvvmimstaaqqpkaqestycavkwavkgliesvrlelkgkpmkiiavypggmatefwe tsgksldtssfmsaedaalmihgalanigngyvsditvnre
>d3guyc_ c.2.1.0 (C:) automated matches {Vibrio parahaemolyticus [TaxId: 419109]} livitgassglgaelaklydaegkatyltgrsesklstvtnclsnnvgyrardlashqev eqlfeqldsipstvvhsagsgyfgllqeqdpeqiqtliennlssainvlrelvkrykdqp vnvvmimstaaqqpkaqestycavkwavkgliesvrlelkgkpmkiiavypggmatefws sfmsaedaalmihgalanigngyvsditvnre
Timeline for d3guyc_: