| Class b: All beta proteins [48724] (174 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein automated matches [190374] (12 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187221] (293 PDB entries) |
| Domain d3gsxa2: 3gsx A:182-274 [199466] Other proteins in same PDB: d3gsxa1, d3gsxb_ automated match to d1x7qa1 |
PDB Entry: 3gsx (more details), 2.1 Å
SCOPe Domain Sequences for d3gsxa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gsxa2 b.1.1.2 (A:182-274) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tdapkthmthhavsdheatlrcwalsfypaeitltwqrdgedqtqdtelvetrpagdgtf
qkwvavvvpsgqeqrytchvqheglpkpltlrw
Timeline for d3gsxa2: