SCOPe 2.03: Domain d3gsua2: 3gsu A:182-275

Lineage for d3gsua2 (3gsu A:182-275)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (12 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (293 PDB entries)

8. Domain d3gsua2: 3gsu A:182-275 [199460]
   Other proteins in same PDB: d3gsua1, d3gsub_
   automated match to d1x7qa1

Details for d3gsua2

PDB Entry: 3gsu, 1.8 Å

PDB Description: crystal structure of the binary complex between hla-a2 and hcmv nlv- m5t peptide variant

PDB Compounds: (A:) HLA class I histocompatibility antigen, A-2 alpha chain

SCOPe Domain Sequences for d3gsua2:

Sequence; same for both SEQRES and ATOM records:

>d3gsua2 b.1.1.2 (A:182-275) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tdapkthmthhavsdheatlrcwalsfypaeitltwqrdgedqtqdtelvetrpagdgtf
qkwvavvvpsgqeqrytchvqheglpkpltlrwe

Timeline for d3gsua2:

• d3gsua2 is new in SCOPe 2.03-stable
  
• d3gsua2 appears in SCOPe 2.04
  
• d3gsua2 appears in the current release, SCOPe 2.08