SCOPe 2.07: Domain d3gsua1: 3gsu A:1-181

Lineage for d3gsua1 (3gsu A:1-181)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein automated matches [191280] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189896] (33 PDB entries)

8. Domain d3gsua1: 3gsu A:1-181 [199459]
   Other proteins in same PDB: d3gsua2, d3gsub1, d3gsub2
   automated match to d1x7qa2

Details for d3gsua1

PDB Entry: 3gsu, 1.8 Å

PDB Description: crystal structure of the binary complex between hla-a2 and hcmv nlv- m5t peptide variant

PDB Compounds: (A:) HLA class I histocompatibility antigen, A-2 alpha chain

SCOPe Domain Sequences for d3gsua1:

Sequence; same for both SEQRES and ATOM records:

>d3gsua1 d.19.1.1 (A:1-181) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw
dgetrkvkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg
kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvewlrrylengketlq
r

Timeline for d3gsua1:

• d3gsua1 first appeared in SCOPe 2.03
  
• d3gsua1 appears in SCOPe 2.06
  
• d3gsua1 appears in the current release, SCOPe 2.08