Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
Protein automated matches [191280] (4 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189896] (32 PDB entries) |
Domain d3gsua1: 3gsu A:1-181 [199459] Other proteins in same PDB: d3gsua2, d3gsub1, d3gsub2 automated match to d1x7qa2 |
PDB Entry: 3gsu (more details), 1.8 Å
SCOPe Domain Sequences for d3gsua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gsua1 d.19.1.1 (A:1-181) automated matches {Human (Homo sapiens) [TaxId: 9606]} gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw dgetrkvkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvewlrrylengketlq r
Timeline for d3gsua1: