SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3gsqa2 (3gsq A:182-274)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2020524Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 protein domains)
  6. 2024392Protein automated matches [190374] (13 species)
    not a true protein
  7. 2024406Species Human (Homo sapiens) [TaxId:9606] [187221] (586 PDB entries)
  8. 2024547Domain d3gsqa2: 3gsq A:182-274 [199456]
    Other proteins in same PDB: d3gsqa1, d3gsqb1, d3gsqb2
    automated match to d1x7qa1

Details for d3gsqa2

PDB Entry: 3gsq (more details), 2.12 Å

PDB Description: crystal structure of the binary complex between hla-a2 and hcmv nlv-m5s peptide variant
PDB Compounds: (A:) HLA class I histocompatibility antigen, A-2 alpha chain

SCOPe Domain Sequences for d3gsqa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gsqa2 b.1.1.2 (A:182-274) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tdapkthmthhavsdheatlrcwalsfypaeitltwqrdgedqtqdtelvetrpagdgtf
qkwvavvvpsgqeqrytchvqheglpkpltlrw

SCOPe Domain Coordinates for d3gsqa2:

Click to download the PDB-style file with coordinates for d3gsqa2.
(The format of our PDB-style files is described here.)

Timeline for d3gsqa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3gsqa1