Lineage for d3gsqa1 (3gsq A:1-181)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1405985Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1405986Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 1405987Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1406849Protein automated matches [191280] (4 species)
    not a true protein
  7. 1406858Species Human (Homo sapiens) [TaxId:9606] [189896] (19 PDB entries)
  8. 1406869Domain d3gsqa1: 3gsq A:1-181 [199455]
    Other proteins in same PDB: d3gsqa2, d3gsqb_
    automated match to d1x7qa2

Details for d3gsqa1

PDB Entry: 3gsq (more details), 2.12 Å

PDB Description: crystal structure of the binary complex between hla-a2 and hcmv nlv- m5s peptide variant
PDB Compounds: (A:) HLA class I histocompatibility antigen, A-2 alpha chain

SCOPe Domain Sequences for d3gsqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gsqa1 d.19.1.1 (A:1-181) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw
dgetrkvkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg
kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvewlrrylengketlq
r

SCOPe Domain Coordinates for d3gsqa1:

Click to download the PDB-style file with coordinates for d3gsqa1.
(The format of our PDB-style files is described here.)

Timeline for d3gsqa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3gsqa2
View in 3D
Domains from other chains:
(mouse over for more information)
d3gsqb_