SCOPe 2.08: Domain d3gsoa2: 3gso A:182-274

Lineage for d3gsoa2 (3gso A:182-274)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d3gsoa2: 3gso A:182-274 [199454]
   Other proteins in same PDB: d3gsoa1, d3gsob1, d3gsob2
   automated match to d1x7qa1

Details for d3gsoa2

PDB Entry: 3gso, 1.6 Å

PDB Description: crystal structure of the binary complex between hla-a2 and hcmv nlv peptide

PDB Compounds: (A:) HLA class I histocompatibility antigen, A-2 alpha chain

SCOPe Domain Sequences for d3gsoa2:

Sequence; same for both SEQRES and ATOM records:

>d3gsoa2 b.1.1.2 (A:182-274) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tdapkthmthhavsdheatlrcwalsfypaeitltwqrdgedqtqdtelvetrpagdgtf
qkwvavvvpsgqeqrytchvqheglpkpltlrw

Timeline for d3gsoa2:

• d3gsoa2 first appeared in SCOPe 2.03
  
• d3gsoa2 appears in SCOPe 2.07