SCOPe 2.07: Domain d3gsnb2: 3gsn B:117-244

Lineage for d3gsnb2 (3gsn B:117-244)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (17 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1235 PDB entries)

8. Domain d3gsnb2: 3gsn B:117-244 [199450]
   Other proteins in same PDB: d3gsna1, d3gsnb1, d3gsnh1, d3gsnl1, d3gsnl2
   automated match to d1qsee2
   complexed with cl, so4

Details for d3gsnb2

PDB Entry: 3gsn, 2.8 Å

PDB Description: crystal structure of the public ra14 tcr in complex with the hcmv dominant nlv/hla-a2 epitope

PDB Compounds: (B:) RA14 TCR beta chain (TRBV6-5, TRBD1, TRBJ1-2)

SCOPe Domain Sequences for d3gsnb2:

Sequence; same for both SEQRES and ATOM records:

>d3gsnb2 b.1.1.2 (B:117-244) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lnkvfppevavfepseaeishtqkatlvclatgffpdhvelswwvngkevhsgvstdpqp
lkeqpalndsryclssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivs
aeawgrad

Timeline for d3gsnb2:

• d3gsnb2 first appeared in SCOPe 2.03
  
• d3gsnb2 appears in SCOPe 2.06
  
• d3gsnb2 appears in the current release, SCOPe 2.08