Lineage for d3gsnb1 (3gsn B:2-116)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2742214Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)
  8. 2743271Domain d3gsnb1: 3gsn B:2-116 [199449]
    Other proteins in same PDB: d3gsna1, d3gsna2, d3gsnb2, d3gsnh1, d3gsnh2, d3gsnl1, d3gsnl2
    automated match to d1qrne1
    complexed with cl, so4

Details for d3gsnb1

PDB Entry: 3gsn (more details), 2.8 Å

PDB Description: crystal structure of the public ra14 tcr in complex with the hcmv dominant nlv/hla-a2 epitope
PDB Compounds: (B:) RA14 TCR beta chain (TRBV6-5, TRBD1, TRBJ1-2)

SCOPe Domain Sequences for d3gsnb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gsnb1 b.1.1.1 (B:2-116) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mgvtqtpkfqvlktgqsmtlqcaqdmnheymswyrqdpgmglrlihysvgagitdqgevp
ngynvsrsttedfplrllsaapsqtsvyfcasspvtggiygytfgsgtrltvved

SCOPe Domain Coordinates for d3gsnb1:

Click to download the PDB-style file with coordinates for d3gsnb1.
(The format of our PDB-style files is described here.)

Timeline for d3gsnb1: