SCOPe 2.04: Domain d3gsna2: 3gsn A:112-200

Lineage for d3gsna2 (3gsn A:112-200)

Root: SCOPe 2.04
Class b: All beta proteins [48724] (176 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein automated matches [190374] (9 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [187221] (385 PDB entries)
Domain d3gsna2: 3gsn A:112-200 [199448]
Other proteins in same PDB: d3gsna1, d3gsnb1, d3gsnh1, d3gsnl_
automated match to d1qrnd2
complexed with cl, so4

Details for d3gsna2

PDB Entry: 3gsn (more details), 2.8 Å

PDB Description: crystal structure of the public ra14 tcr in complex with the hcmv dominant nlv/hla-a2 epitope

PDB Compounds: (A:) RA14 TCR alpha chain (TRAV24, TRAJ49)

SCOPe Domain Sequences for d3gsna2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gsna2 b.1.1.2 (A:112-200) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdayitdktvldmrsmdfksns
avawsnksdfacanafnnsiipedtffps

SCOPe Domain Coordinates for d3gsna2:

Click to download the PDB-style file with coordinates for d3gsna2.
(The format of our PDB-style files is described here.)

Timeline for d3gsna2: