Lineage for d3gsna1 (3gsn A:2-111)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (24 species)
    not a true protein
  7. 2355363Species Human (Homo sapiens) [TaxId:9606] [187920] (1030 PDB entries)
  8. 2356886Domain d3gsna1: 3gsn A:2-111 [199447]
    Other proteins in same PDB: d3gsna2, d3gsnb1, d3gsnb2, d3gsnh1, d3gsnh2, d3gsnl1, d3gsnl2
    automated match to d1qrnd1
    complexed with cl, so4

Details for d3gsna1

PDB Entry: 3gsn (more details), 2.8 Å

PDB Description: Crystal structure of the public RA14 TCR in complex with the HCMV dominant NLV/HLA-A2 epitope
PDB Compounds: (A:) RA14 TCR alpha chain (TRAV24, TRAJ49)

SCOPe Domain Sequences for d3gsna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gsna1 b.1.1.0 (A:2-111) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lnveqspqslhvqegdstnftcsfpssnfyalhwyrwetakspealfvmtlngdekkkgr
isatlntkegysylyikgsqpedsatylcarntgnqfyfgtgtsltvipn

SCOPe Domain Coordinates for d3gsna1:

Click to download the PDB-style file with coordinates for d3gsna1.
(The format of our PDB-style files is described here.)

Timeline for d3gsna1: