SCOPe 2.08: Domain d3gsna1: 3gsn A:2-111

Lineage for d3gsna1 (3gsn A:2-111)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d3gsna1: 3gsn A:2-111 [199447]
   Other proteins in same PDB: d3gsna2, d3gsnb1, d3gsnb2, d3gsnh1, d3gsnh2, d3gsnl1, d3gsnl2
   automated match to d1qrnd1
   complexed with cl, so4

Details for d3gsna1

PDB Entry: 3gsn, 2.8 Å

PDB Description: crystal structure of the public ra14 tcr in complex with the hcmv dominant nlv/hla-a2 epitope

PDB Compounds: (A:) RA14 TCR alpha chain (TRAV24, TRAJ49)

SCOPe Domain Sequences for d3gsna1:

Sequence; same for both SEQRES and ATOM records:

>d3gsna1 b.1.1.0 (A:2-111) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lnveqspqslhvqegdstnftcsfpssnfyalhwyrwetakspealfvmtlngdekkkgr
isatlntkegysylyikgsqpedsatylcarntgnqfyfgtgtsltvipn

Timeline for d3gsna1:

• d3gsna1 first appeared in SCOPe 2.03
  
• d3gsna1 appears in SCOPe 2.07