Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.92: Chelatase-like [53799] (3 superfamilies) duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.92.2: "Helical backbone" metal receptor [53807] (5 families) contains a long alpha helical insertion in the interdomain linker |
Family c.92.2.0: automated matches [191548] (1 protein) not a true family |
Protein automated matches [190944] (18 species) not a true protein |
Species Streptococcus pyogenes [TaxId:1314] [196552] (1 PDB entry) |
Domain d3gi1a_: 3gi1 A: [199442] automated match to d3gi1b_ complexed with zn |
PDB Entry: 3gi1 (more details), 2.45 Å
SCOPe Domain Sequences for d3gi1a_:
Sequence, based on SEQRES records: (download)
>d3gi1a_ c.92.2.0 (A:) automated matches {Streptococcus pyogenes [TaxId: 1314]} tqgmsvvtsfypmyamtkevsgdlndvrmiqsgagihsfepsvndvaaiydadlfvyhsh tleawardldpnlkkskvdvfeaskpltldrvkgledmevtqgidpatlydphtwtdpvl ageeavniakelgrldpkhkdsytknakafkkeaeqlteeytqkfkkvrsktfvtqhtaf sylakrfglkqlgisgispeqepsprqlkeiqdfvkeynvktifaednvnpkiahaiaks tgakvktlspleaapsgnktylenlranlevlyqqlk
>d3gi1a_ c.92.2.0 (A:) automated matches {Streptococcus pyogenes [TaxId: 1314]} tqgmsvvtsfypmyamtkevsgdlndvrmiihsfepsvndvaaiydadlfvyhshtleaw ardldpnlkkskvdvfeaskpltldrvklydphtwtdpvlageeavniakelgrldpkhk dsytknakafkkeaeqlteeytqkfkkvrsktfvtqhtafsylakrfglkqlgisgispp sprqlkeiqdfvkeynvktifaednvnpkiahaiakstgakvktlspleaapsgnktyle nlranlevlyqqlk
Timeline for d3gi1a_: