Lineage for d3gi1a_ (3gi1 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2143226Fold c.92: Chelatase-like [53799] (3 superfamilies)
    duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134
  4. 2143333Superfamily c.92.2: "Helical backbone" metal receptor [53807] (5 families) (S)
    contains a long alpha helical insertion in the interdomain linker
  5. 2143580Family c.92.2.0: automated matches [191548] (1 protein)
    not a true family
  6. 2143581Protein automated matches [190944] (35 species)
    not a true protein
  7. 2143679Species Streptococcus pyogenes [TaxId:1314] [196552] (1 PDB entry)
  8. 2143680Domain d3gi1a_: 3gi1 A: [199442]
    automated match to d3gi1b_
    complexed with zn

Details for d3gi1a_

PDB Entry: 3gi1 (more details), 2.45 Å

PDB Description: Crystal Structure of the laminin-binding protein Lbp of Streptococcus pyogenes
PDB Compounds: (A:) Laminin-binding protein of group A streptococci

SCOPe Domain Sequences for d3gi1a_:

Sequence, based on SEQRES records: (download)

>d3gi1a_ c.92.2.0 (A:) automated matches {Streptococcus pyogenes [TaxId: 1314]}
tqgmsvvtsfypmyamtkevsgdlndvrmiqsgagihsfepsvndvaaiydadlfvyhsh
tleawardldpnlkkskvdvfeaskpltldrvkgledmevtqgidpatlydphtwtdpvl
ageeavniakelgrldpkhkdsytknakafkkeaeqlteeytqkfkkvrsktfvtqhtaf
sylakrfglkqlgisgispeqepsprqlkeiqdfvkeynvktifaednvnpkiahaiaks
tgakvktlspleaapsgnktylenlranlevlyqqlk

Sequence, based on observed residues (ATOM records): (download)

>d3gi1a_ c.92.2.0 (A:) automated matches {Streptococcus pyogenes [TaxId: 1314]}
tqgmsvvtsfypmyamtkevsgdlndvrmiihsfepsvndvaaiydadlfvyhshtleaw
ardldpnlkkskvdvfeaskpltldrvklydphtwtdpvlageeavniakelgrldpkhk
dsytknakafkkeaeqlteeytqkfkkvrsktfvtqhtafsylakrfglkqlgisgispp
sprqlkeiqdfvkeynvktifaednvnpkiahaiakstgakvktlspleaapsgnktyle
nlranlevlyqqlk

SCOPe Domain Coordinates for d3gi1a_:

Click to download the PDB-style file with coordinates for d3gi1a_.
(The format of our PDB-style files is described here.)

Timeline for d3gi1a_: