Lineage for d3geta1 (3get A:1-364)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2147071Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2147072Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2148410Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2148411Protein automated matches [190151] (121 species)
    not a true protein
  7. 2148572Species Campylobacter jejuni [TaxId:192222] [196590] (3 PDB entries)
  8. 2148575Domain d3geta1: 3get A:1-364 [199441]
    Other proteins in same PDB: d3geta2
    automated match to d3getb_
    complexed with gol, ipa

Details for d3geta1

PDB Entry: 3get (more details), 2.01 Å

PDB Description: crystal structure of putative histidinol-phosphate aminotransferase (np_281508.1) from campylobacter jejuni at 2.01 a resolution
PDB Compounds: (A:) Histidinol-phosphate aminotransferase

SCOPe Domain Sequences for d3geta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3geta1 c.67.1.0 (A:1-364) automated matches {Campylobacter jejuni [TaxId: 192222]}
mkfneflnnlsnyepgkdieviakeygvkeviklasnenpfgtppkaieclrqnankahl
ypddsmielkstlaqkykvqneniiigagsdqviefaihsklnsknaflqagvtfamyei
yakqcgakcyktqsithnldefkklyethkdeikliflclpnnplgecldaseatefikg
vnedclvvidaaynefasfkdskkhlepcelikefdnvlylgtfsklyglgglrigygia
naniisafyklrapfnvsnlalkaavaamdddeftektlennfsqmelykefakkhniki
idsytnfityffdeknstdlsekllkkgiiirnlksyglnairitigtsyenekfftefd
kilr

SCOPe Domain Coordinates for d3geta1:

Click to download the PDB-style file with coordinates for d3geta1.
(The format of our PDB-style files is described here.)

Timeline for d3geta1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3geta2
View in 3D
Domains from other chains:
(mouse over for more information)
d3getb_