Lineage for d3geta_ (3get A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1613158Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 1613159Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 1614338Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 1614339Protein automated matches [190151] (83 species)
    not a true protein
  7. 1614442Species Campylobacter jejuni [TaxId:192222] [196590] (3 PDB entries)
  8. 1614445Domain d3geta_: 3get A: [199441]
    automated match to d3getb_
    complexed with gol, ipa

Details for d3geta_

PDB Entry: 3get (more details), 2.01 Å

PDB Description: crystal structure of putative histidinol-phosphate aminotransferase (np_281508.1) from campylobacter jejuni at 2.01 a resolution
PDB Compounds: (A:) Histidinol-phosphate aminotransferase

SCOPe Domain Sequences for d3geta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3geta_ c.67.1.0 (A:) automated matches {Campylobacter jejuni [TaxId: 192222]}
gmkfneflnnlsnyepgkdieviakeygvkeviklasnenpfgtppkaieclrqnankah
lypddsmielkstlaqkykvqneniiigagsdqviefaihsklnsknaflqagvtfamye
iyakqcgakcyktqsithnldefkklyethkdeikliflclpnnplgecldaseatefik
gvnedclvvidaaynefasfkdskkhlepcelikefdnvlylgtfsklyglgglrigygi
ananiisafyklrapfnvsnlalkaavaamdddeftektlennfsqmelykefakkhnik
iidsytnfityffdeknstdlsekllkkgiiirnlksyglnairitigtsyenekfftef
dkilr

SCOPe Domain Coordinates for d3geta_:

Click to download the PDB-style file with coordinates for d3geta_.
(The format of our PDB-style files is described here.)

Timeline for d3geta_: