Lineage for d3gbnl1 (3gbn L:3-106A)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2365565Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)
  8. 2366335Domain d3gbnl1: 3gbn L:3-106A [199440]
    Other proteins in same PDB: d3gbna1, d3gbna2, d3gbnb_
    automated match to d1aqkl1
    complexed with cl, edo, etx, gol, nag, unl

Details for d3gbnl1

PDB Entry: 3gbn (more details), 2.2 Å

PDB Description: crystal structure of fab cr6261 in complex with the 1918 h1n1 influenza virus hemagglutinin
PDB Compounds: (L:) Fab Lambda Light Chain

SCOPe Domain Sequences for d3gbnl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gbnl1 b.1.1.0 (L:3-106A) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vltqppsvsaapgqkvtiscsgsssnigndyvswyqqlpgtapklliydnnkrpsgipdr
fsgsksgtsatlgitglqtgdeanyycatwdrrptayvvfgggtkltvl

SCOPe Domain Coordinates for d3gbnl1:

Click to download the PDB-style file with coordinates for d3gbnl1.
(The format of our PDB-style files is described here.)

Timeline for d3gbnl1: