SCOPe 2.05: Domain d3gbnl1: 3gbn L:3-106A

Lineage for d3gbnl1 (3gbn L:3-106A)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (26 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (558 PDB entries)

8. Domain d3gbnl1: 3gbn L:3-106A [199440]
   Other proteins in same PDB: d3gbna_, d3gbnb_
   automated match to d1aqkl1
   complexed with cl, edo, etx, gol, nag, unl

Details for d3gbnl1

PDB Entry: 3gbn, 2.2 Å

PDB Description: crystal structure of fab cr6261 in complex with the 1918 h1n1 influenza virus hemagglutinin

PDB Compounds: (L:) Fab Lambda Light Chain

SCOPe Domain Sequences for d3gbnl1:

Sequence; same for both SEQRES and ATOM records:

>d3gbnl1 b.1.1.0 (L:3-106A) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vltqppsvsaapgqkvtiscsgsssnigndyvswyqqlpgtapklliydnnkrpsgipdr
fsgsksgtsatlgitglqtgdeanyycatwdrrptayvvfgggtkltvl

Timeline for d3gbnl1:

• d3gbnl1 first appeared in SCOPe 2.03
  
• d3gbnl1 appears in SCOPe 2.04
  
• d3gbnl1 appears in SCOPe 2.06
  
• d3gbnl1 appears in the current release, SCOPe 2.08