Lineage for d3gbmm2 (3gbm M:112-211)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2749887Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
  8. 2751350Domain d3gbmm2: 3gbm M:112-211 [199439]
    Other proteins in same PDB: d3gbma1, d3gbma2, d3gbmb1, d3gbmb2, d3gbmc1, d3gbmc2, d3gbmd_, d3gbmh_, d3gbmi_, d3gbml1, d3gbmm1
    automated match to d1aqkl2
    complexed with bma, edo, gol, nag

Details for d3gbmm2

PDB Entry: 3gbm (more details), 2.7 Å

PDB Description: crystal structure of fab cr6261 in complex with a h5n1 influenza virus hemagglutinin.
PDB Compounds: (M:) antibody (Fab)

SCOPe Domain Sequences for d3gbmm2:

Sequence, based on SEQRES records: (download)

>d3gbmm2 b.1.1.2 (M:112-211) automated matches {Human (Homo sapiens) [TaxId: 9606]}
apsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnk
yaassylsltpeqwkshrsyscqvthegstvektvap

Sequence, based on observed residues (ATOM records): (download)

>d3gbmm2 b.1.1.2 (M:112-211) automated matches {Human (Homo sapiens) [TaxId: 9606]}
apsvtlfppsseelqankatlvclisdfypgavtvawkaagvetttpskqsnnkyaassy
lsltpeqwkshrsyscqvthestvektvap

SCOPe Domain Coordinates for d3gbmm2:

Click to download the PDB-style file with coordinates for d3gbmm2.
(The format of our PDB-style files is described here.)

Timeline for d3gbmm2: