Lineage for d3gbmm1 (3gbm M:3-106A)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1764871Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1764872Protein automated matches [190740] (26 species)
    not a true protein
  7. 1765207Species Human (Homo sapiens) [TaxId:9606] [187920] (558 PDB entries)
  8. 1765973Domain d3gbmm1: 3gbm M:3-106A [199438]
    Other proteins in same PDB: d3gbma_, d3gbmb_, d3gbmc_, d3gbmd_, d3gbml2, d3gbmm2
    automated match to d1aqkl1
    complexed with bma, edo, gol, nag

Details for d3gbmm1

PDB Entry: 3gbm (more details), 2.7 Å

PDB Description: Crystal Structure of Fab CR6261 in Complex with a H5N1 influenza virus hemagglutinin.
PDB Compounds: (M:) antibody (Fab)

SCOPe Domain Sequences for d3gbmm1:

Sequence, based on SEQRES records: (download)

>d3gbmm1 b.1.1.0 (M:3-106A) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vltqppsvsaapgqkvtiscsgsssnigndyvswyqqlpgtapklliydnnkrpsgipdr
fsgsksgtsatlgitglqtgdeanyycatwdrrptayvvfgggtkltvl

Sequence, based on observed residues (ATOM records): (download)

>d3gbmm1 b.1.1.0 (M:3-106A) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vltqppsvsaapgqkvtiscsgsssnigndyvswyqqlpgtapklliydnnkrpsgipdr
fsgsksgtsatlgitglqtgdeanyycatwdrtayvvfgggtkltvl

SCOPe Domain Coordinates for d3gbmm1:

Click to download the PDB-style file with coordinates for d3gbmm1.
(The format of our PDB-style files is described here.)

Timeline for d3gbmm1: