SCOPe 2.06: Domain d3gbml1: 3gbm L:3-105

Lineage for d3gbml1 (3gbm L:3-105)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (28 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries)

8. Domain d3gbml1: 3gbm L:3-105 [199436]
   Other proteins in same PDB: d3gbma1, d3gbma2, d3gbmb1, d3gbmb2, d3gbmc1, d3gbmc2, d3gbmd_, d3gbml2, d3gbmm2
   automated match to d1aqkl1
   complexed with bma, edo, gol, nag

Details for d3gbml1

PDB Entry: 3gbm, 2.7 Å

PDB Description: crystal structure of fab cr6261 in complex with a h5n1 influenza virus hemagglutinin.

PDB Compounds: (L:) antibody (Fab)

SCOPe Domain Sequences for d3gbml1:

Sequence, based on SEQRES records:

>d3gbml1 b.1.1.0 (L:3-105) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vltqppsvsaapgqkvtiscsgsssnigndyvswyqqlpgtapklliydnnkrpsgipdr
fsgsksgtsatlgitglqtgdeanyycatwdrrptayvvfgggtklt

Sequence, based on observed residues (ATOM records):

>d3gbml1 b.1.1.0 (L:3-105) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vltqppsvsaapgqkvtiscsgsssnigndyvswyqqlpgtapklliydnnkrpsgipdr
fsgsksgtsatlgitglqtgdeanyycatwdrtayvvfgggtklt

Timeline for d3gbml1:

• d3gbml1 first appeared in SCOPe 2.03
  
• d3gbml1 appears in SCOPe 2.05
  
• d3gbml1 appears in SCOPe 2.07
  
• d3gbml1 appears in the current release, SCOPe 2.08