Lineage for d3gbml1 (3gbm L:3-105)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1295808Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1295809Protein automated matches [190740] (23 species)
    not a true protein
  7. 1295971Species Human (Homo sapiens) [TaxId:9606] [187920] (336 PDB entries)
  8. 1296510Domain d3gbml1: 3gbm L:3-105 [199436]
    Other proteins in same PDB: d3gbma_, d3gbmc_, d3gbml2, d3gbmm2
    automated match to d1aqkl1
    complexed with bma, edo, gol, nag

Details for d3gbml1

PDB Entry: 3gbm (more details), 2.7 Å

PDB Description: Crystal Structure of Fab CR6261 in Complex with a H5N1 influenza virus hemagglutinin.
PDB Compounds: (L:) antibody (Fab)

SCOPe Domain Sequences for d3gbml1:

Sequence, based on SEQRES records: (download)

>d3gbml1 b.1.1.0 (L:3-105) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vltqppsvsaapgqkvtiscsgsssnigndyvswyqqlpgtapklliydnnkrpsgipdr
fsgsksgtsatlgitglqtgdeanyycatwdrrptayvvfgggtklt

Sequence, based on observed residues (ATOM records): (download)

>d3gbml1 b.1.1.0 (L:3-105) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vltqppsvsaapgqkvtiscsgsssnigndyvswyqqlpgtapklliydnnkrpsgipdr
fsgsksgtsatlgitglqtgdeanyycatwdrtayvvfgggtklt

SCOPe Domain Coordinates for d3gbml1:

Click to download the PDB-style file with coordinates for d3gbml1.
(The format of our PDB-style files is described here.)

Timeline for d3gbml1: