SCOPe 2.06: Domain d3g64b_: 3g64 B:

Lineage for d3g64b_ (3g64 B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.14: ClpP/crotonase [52095] (1 superfamily)
   core: 4 turns of (beta-beta-alpha)n superhelix

4. Superfamily c.14.1: ClpP/crotonase [52096] (5 families)

5. Family c.14.1.0: automated matches [191346] (1 protein)
   not a true family

6. Protein automated matches [190246] (54 species)
   not a true protein

7. Species Streptomyces coelicolor [TaxId:100226] [196597] (1 PDB entry)

8. Domain d3g64b_: 3g64 B: [199434]
   automated match to d3g64c_
   complexed with edo, gol, so4, zn

Details for d3g64b_

PDB Entry: 3g64, 2.05 Å

PDB Description: Crystal structure of putative enoyl-CoA hydratase from Streptomyces coelicolor A3(2)

PDB Compounds: (B:) Putative enoyl-CoA hydratase

SCOPe Domain Sequences for d3g64b_:

Sequence; same for both SEQRES and ATOM records:

>d3g64b_ c.14.1.0 (B:) automated matches {Streptomyces coelicolor [TaxId: 100226]}
spftgsaaptpewrhlrveitdgvatvtlarpdklnaltfeayadlrdllaelsrrravr
alvlagegrgfcsggdvdeiigatlsmdtarlldfnrmtgqvvravrecpfpviaalhgv
aagagavlalaadfrvadpstrfaflftrvglsggdmgaayllprvvglghatrllmlgd
tvrapeaerigliselteegradeaartlarrladgpalahaqtkalltaeldmplaaav
eldastqallmtgedyaefhaaftekrppkwqgr

Timeline for d3g64b_:

• d3g64b_ first appeared in SCOPe 2.03
  
• d3g64b_ appears in SCOPe 2.05
  
• d3g64b_ appears in SCOPe 2.07
  
• d3g64b_ appears in the current release, SCOPe 2.08