Lineage for d3g1qc_ (3g1q C:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2005528Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2005529Protein automated matches [190847] (63 species)
    not a true protein
  7. 2006000Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [194968] (7 PDB entries)
  8. 2006007Domain d3g1qc_: 3g1q C: [199432]
    automated match to d3g1qd_
    complexed with hem

Details for d3g1qc_

PDB Entry: 3g1q (more details), 1.89 Å

PDB Description: crystal structure of sterol 14-alpha demethylase (cyp51) from trypanosoma brucei in ligand free state
PDB Compounds: (C:) Sterol 14-alpha-demethylase

SCOPe Domain Sequences for d3g1qc_:

Sequence, based on SEQRES records: (download)

>d3g1qc_ a.104.1.0 (C:) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
skgklppvypvtvpilghiiqfgksplgfmqeckrqlksgiftinivgkrvtivgdpheh
srfflprnevlsprevysfmvpvfgegvayaapyprmreqlnflaeeltiakfqnfvpai
qhevrkfmaanwdkdegeinlledcstmiintacqclfgedlrkrldarrfaqllakmes
slipaavflpillklplpqsarcheartelqkilseiiiarkeeevnkdsstsdllsgll
savyrdgtpmslhevcgmivaamfagqhtssitttwsmlhlmhpanvkhlealrkeieef
paqlnynnvmdempfaercaresirrdppllmlmrkvmadvkvgsyvvpkgdiiacspll
shhdeeafpeprrwdperdekvegafigfgagvhkcigqkfgllqvktilatafrsydfq
llrdevpdpdyhtmvvgptasqcrvkyirr

Sequence, based on observed residues (ATOM records): (download)

>d3g1qc_ a.104.1.0 (C:) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
skgklppvypvtvpilghiiqfgksplgfmqeckrqlksgiftinivgkrvtivgdpheh
srfflprnevlsprevysfmvpvfgegvayaapyprmreqlnflaeeltiakfqnfvpai
qhevrkfmaanwdkdegeinlledcstmiintacqclfgedlrkrldarrfaqllakmes
slipaavflpillklplpqsarcheartelqkilseiiiarkeeevnktsdllsgllsav
yrdgtpmslhevcgmivaamfagqhtssitttwsmlhlmhpanvkhlealrkeieefpaq
lnynnvmdempfaercaresirrdppllmlmrkvmadvkvgsyvvpkgdiiacspllshh
deeafpeprrwdperdekvegafigfgagvhkcigqkfgllqvktilatafrsydfqllr
devpdpdyhtmvvgptasqcrvkyirr

SCOPe Domain Coordinates for d3g1qc_:

Click to download the PDB-style file with coordinates for d3g1qc_.
(The format of our PDB-style files is described here.)

Timeline for d3g1qc_: