SCOP 1.59: Domain d1a7oh_: 1a7o H:

Lineage for d1a7oh_ (1a7o H:)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species)

7. Species Fab D1.3 (mouse), kappa L chain [48784] (19 PDB entries)

8. Domain d1a7oh_: 1a7o H: [19943]

Details for d1a7oh_

PDB Entry: 1a7o, 2 Å

PDB Description: fv fragment of mouse monoclonal antibody d1.3 (balb/c, igg1, k) r96l deletion mutant on variant for chain l glu81->asp and chain h leu312->val

SCOP Domain Sequences for d1a7oh_:

Sequence; same for both SEQRES and ATOM records:

>d1a7oh_ b.1.1.1 (H:) Immunoglobulin (variable domains of L and H chains) {Fab D1.3 (mouse), kappa L chain}
qvqlqesgpglvapsqslsitctvsgfsltgygvnwvrqppgkglewlgmiwgdgntdyn
salksrlsiskdnsksqvflkmnslhtddtaryycarerdyrldywgqgttvtvss

Timeline for d1a7oh_:

• d1a7oh_ first appeared (with stable ids) in SCOP 1.55
  
• d1a7oh_ appears in SCOP 1.57
  
• d1a7oh_ appears in SCOP 1.61
  
• d1a7oh_ appears in the current release, SCOPe 2.08