Lineage for d1a7oh_ (1a7o H:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 51642Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 51698Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species)
  7. 52252Species Fab D1.3 (mouse), kappa L chain [48784] (19 PDB entries)
  8. 52269Domain d1a7oh_: 1a7o H: [19943]

Details for d1a7oh_

PDB Entry: 1a7o (more details), 2 Å

PDB Description: fv fragment of mouse monoclonal antibody d1.3 (balb/c, igg1, k) r96l deletion mutant on variant for chain l glu81->asp and chain h leu312->val

SCOP Domain Sequences for d1a7oh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a7oh_ b.1.1.1 (H:) Immunoglobulin (variable domains of L and H chains) {Fab D1.3 (mouse), kappa L chain}
qvqlqesgpglvapsqslsitctvsgfsltgygvnwvrqppgkglewlgmiwgdgntdyn
salksrlsiskdnsksqvflkmnslhtddtaryycarerdyrldywgqgttvtvss

SCOP Domain Coordinates for d1a7oh_:

Click to download the PDB-style file with coordinates for d1a7oh_.
(The format of our PDB-style files is described here.)

Timeline for d1a7oh_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1a7ol_