Lineage for d3g08a1 (3g08 A:7-185)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2938649Family d.19.1.0: automated matches [227140] (1 protein)
    not a true family
  6. 2938650Protein automated matches [226842] (5 species)
    not a true protein
  7. 2938889Species Mouse (Mus musculus) [TaxId:10090] [224924] (70 PDB entries)
  8. 2938890Domain d3g08a1: 3g08 A:7-185 [199428]
    Other proteins in same PDB: d3g08a2, d3g08b_
    automated match to d1onqa2
    complexed with fee, nag, plm

Details for d3g08a1

PDB Entry: 3g08 (more details), 1.6 Å

PDB Description: crystal structure of the alpha-galactosylceramide analog och in complex with mouse cd1d
PDB Compounds: (A:) T-cell surface glycoprotein CD1d1

SCOPe Domain Sequences for d3g08a1:

Sequence, based on SEQRES records: (download)

>d3g08a1 d.19.1.0 (A:7-185) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
nytfrclqmssfanrswsrtdsvvwlgdlqthrwsndsatisftkpwsqgklsnqqwekl
qhmfqvyrvsftrdiqelvkmmspkedypieiqlsagcemypgnasesflhvafqgkyvv
rfwgtswqtvpgapswldlpikvlnadqgtsatvqmllndtcplfvrglleagksdlek

Sequence, based on observed residues (ATOM records): (download)

>d3g08a1 d.19.1.0 (A:7-185) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
nytfrclqmssfanrswsrtdsvvwlgdlqthrwsndsatisftkpwsqgklsnqqwekl
qhmfqvyrvsftrdiqelvkmmedypieiqlsagcemyasesflhvafqgkyvvrfwgts
wqtvpgapswldlpikvlnadqgtsatvqmllndtcplfvrglleagksdlek

SCOPe Domain Coordinates for d3g08a1:

Click to download the PDB-style file with coordinates for d3g08a1.
(The format of our PDB-style files is described here.)

Timeline for d3g08a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3g08a2
View in 3D
Domains from other chains:
(mouse over for more information)
d3g08b_