Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) many members have left-handed crossover connection between strand 8 and additional strand 9 |
Family c.69.1.25: Acetyl xylan esterase-like [82504] (3 proteins) Pfam PF05448; AXE1 |
Protein automated matches [191114] (2 species) not a true protein |
Species Bacillus pumilus [TaxId:1408] [189177] (6 PDB entries) |
Domain d3fyua_: 3fyu A: [199422] automated match to d3fvti_ complexed with acy, cl, edo, xyp |
PDB Entry: 3fyu (more details), 2.62 Å
SCOPe Domain Sequences for d3fyua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3fyua_ c.69.1.25 (A:) automated matches {Bacillus pumilus [TaxId: 1408]} mqlfdlsleelkkykpkktarpdfsdfwkksleelrqveaeptlesydypvkgvkvyrlt yqsfghskiegfyavpdqtgphpalvrfhgynasydggihdivnwalhgyatfgmlvrgq ggsedtsvtpgghalgwmtkgilskdtyyyrgvyldavraleviqsfpevdehrigvigg sqggalaiaaaalsdipkvvvadypylsnferavdvaleqpyleinsyfrrnsdpkveek afetlsyfdlinlagwvkqptlmaiglidkitppstvfaaynhletdkdlkvyryfghef ipafqteklsflqkhlll
Timeline for d3fyua_: