Lineage for d1a7ol_ (1a7o L:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 450779Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 450780Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (27 proteins)
  6. 451612Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 452039Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88531] (162 PDB entries)
  8. 452067Domain d1a7ol_: 1a7o L: [19942]
    Other proteins in same PDB: d1a7oh_
    part of Fv D1.3

Details for d1a7ol_

PDB Entry: 1a7o (more details), 2 Å

PDB Description: fv fragment of mouse monoclonal antibody d1.3 (balb/c, igg1, k) r96l deletion mutant on variant for chain l glu81->asp and chain h leu312->val

SCOP Domain Sequences for d1a7ol_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a7ol_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4}
divltqspaslsasvgetvtitcrasgnihnylawyqqkqgkspqllvyytttladgvps
rfsgsgsgtqyslkinslqpddfgsyycqhfwstptfgggtkleik

SCOP Domain Coordinates for d1a7ol_:

Click to download the PDB-style file with coordinates for d1a7ol_.
(The format of our PDB-style files is described here.)

Timeline for d1a7ol_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1a7oh_