SCOPe 2.07: Domain d3fvtl_: 3fvt L:

Lineage for d3fvtl_ (3fvt L:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.25: Acetyl xylan esterase-like [82504] (3 protein domains)
   Pfam PF05448; AXE1

6. Protein automated matches [191114] (2 species)
   not a true protein

7. Species Bacillus pumilus [TaxId:1408] [189177] (6 PDB entries)

8. Domain d3fvtl_: 3fvt L: [199418]
   automated match to d3fvti_
   complexed with cl, gol

Details for d3fvtl_

PDB Entry: 3fvt, 1.9 Å

PDB Description: crystal structure of acetyl xylan esterase from bacillus pumilus, monoclinic crystal form ii

PDB Compounds: (L:) acetyl xylan esterase

SCOPe Domain Sequences for d3fvtl_:

Sequence; same for both SEQRES and ATOM records:

>d3fvtl_ c.69.1.25 (L:) automated matches {Bacillus pumilus [TaxId: 1408]}
qlfdlsleelkkykpkktarpdfsdfwkksleelrqveaeptlesydypvkgvkvyrlty
qsfghskiegfyavpdqtgphpalvrfhgynasydggihdivnwalhgyatfgmlvrgqg
gsedtsvtpgghalgwmtkgilskdtyyyrgvyldavraleviqsfpevdehrigviggs
qggalaiaaaalsdipkvvvadypylsnferavdvaleqpyleinsyfrrnsdpkveeka
fetlsyfdlinlagwvkqptlmaiglidkitppstvfaaynhletdkdlkvyryfghefi
pafqteklsflqkhlll

Timeline for d3fvtl_:

• d3fvtl_ first appeared in SCOPe 2.03
  
• d3fvtl_ appears in SCOPe 2.06