Lineage for d3fvta_ (3fvt A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1382311Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 1382312Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 1383808Family c.69.1.25: Acetyl xylan esterase-like [82504] (3 proteins)
    Pfam PF05448; AXE1
  6. 1383837Protein automated matches [191114] (2 species)
    not a true protein
  7. 1383838Species Bacillus pumilus [TaxId:1408] [189177] (6 PDB entries)
  8. 1383851Domain d3fvta_: 3fvt A: [199410]
    automated match to d3fvti_
    complexed with cl, gol

Details for d3fvta_

PDB Entry: 3fvt (more details), 1.9 Å

PDB Description: crystal structure of acetyl xylan esterase from bacillus pumilus, monoclinic crystal form ii
PDB Compounds: (A:) acetyl xylan esterase

SCOPe Domain Sequences for d3fvta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fvta_ c.69.1.25 (A:) automated matches {Bacillus pumilus [TaxId: 1408]}
mqlfdlsleelkkykpkktarpdfsdfwkksleelrqveaeptlesydypvkgvkvyrlt
yqsfghskiegfyavpdqtgphpalvrfhgynasydggihdivnwalhgyatfgmlvrgq
ggsedtsvtpgghalgwmtkgilskdtyyyrgvyldavraleviqsfpevdehrigvigg
sqggalaiaaaalsdipkvvvadypylsnferavdvaleqpyleinsyfrrnsdpkveek
afetlsyfdlinlagwvkqptlmaiglidkitppstvfaaynhletdkdlkvyryfghef
ipafqteklsflqkhlll

SCOPe Domain Coordinates for d3fvta_:

Click to download the PDB-style file with coordinates for d3fvta_.
(The format of our PDB-style files is described here.)

Timeline for d3fvta_: