Lineage for d3ftga2 (3ftg A:182-275)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1290587Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1291448Protein Class I MHC, alpha-3 domain [88604] (4 species)
  7. 1291720Species Mouse (Mus musculus) [TaxId:10090] [88606] (101 PDB entries)
    Uniprot P01901 22-299
  8. 1291840Domain d3ftga2: 3ftg A:182-275 [199409]
    Other proteins in same PDB: d3ftga1, d3ftgb_
    automated match to d1jpfa1

Details for d3ftga2

PDB Entry: 3ftg (more details), 2.6 Å

PDB Description: Crystal Structure of H2Db in complex with NP366-N3A variant peptide from influenza
PDB Compounds: (A:) H-2 class I histocompatibility antigen, D-B alpha chain

SCOPe Domain Sequences for d3ftga2:

Sequence, based on SEQRES records: (download)

>d3ftga2 b.1.1.2 (A:182-275) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
tdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgtf
qkwasvvvplgkeqnytcrvyheglpepltlrwe

Sequence, based on observed residues (ATOM records): (download)

>d3ftga2 b.1.1.2 (A:182-275) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
tdspkahvtrcwalgfypaditltwqlelvetrpagdgtfqkwasqnytcrvyheglpep
ltlrwe

SCOPe Domain Coordinates for d3ftga2:

Click to download the PDB-style file with coordinates for d3ftga2.
(The format of our PDB-style files is described here.)

Timeline for d3ftga2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3ftga1
View in 3D
Domains from other chains:
(mouse over for more information)
d3ftgb_