SCOPe 2.03: Domain d3ftga2: 3ftg A:182-275

Lineage for d3ftga2 (3ftg A:182-275)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Class I MHC, alpha-3 domain [88604] (4 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88606] (101 PDB entries)
   Uniprot P01901 22-299

8. Domain d3ftga2: 3ftg A:182-275 [199409]
   Other proteins in same PDB: d3ftga1, d3ftgb_
   automated match to d1jpfa1

Details for d3ftga2

PDB Entry: 3ftg, 2.6 Å

PDB Description: Crystal Structure of H2Db in complex with NP366-N3A variant peptide from influenza

PDB Compounds: (A:) H-2 class I histocompatibility antigen, D-B alpha chain

SCOPe Domain Sequences for d3ftga2:

Sequence, based on SEQRES records:

>d3ftga2 b.1.1.2 (A:182-275) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
tdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgtf
qkwasvvvplgkeqnytcrvyheglpepltlrwe

Sequence, based on observed residues (ATOM records):

>d3ftga2 b.1.1.2 (A:182-275) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
tdspkahvtrcwalgfypaditltwqlelvetrpagdgtfqkwasqnytcrvyheglpep
ltlrwe

Timeline for d3ftga2:

• d3ftga2 is new in SCOPe 2.03-stable
  
• d3ftga2 appears in SCOPe 2.04
  
• d3ftga2 appears in the current release, SCOPe 2.08