SCOPe 2.03: Domain d3fi5b_: 3fi5 B:

Lineage for d3fi5b_ (3fi5 B:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (12 families)

5. Family d.2.1.3: Phage lysozyme [53981] (4 proteins)

6. Protein Phage T4 lysozyme [53982] (1 species)

7. Species Bacteriophage T4 [TaxId:10665] [53983] (542 PDB entries)
   Uniprot P00720
   many mutant structures

8. Domain d3fi5b_: 3fi5 B: [199406]
   automated match to d3fi5d_
   complexed with cl, ipa, na; mutant

Details for d3fi5b_

PDB Entry: 3fi5, 1.53 Å

PDB Description: crystal structure of t4 lysozyme mutant r96w

PDB Compounds: (B:) lysozyme

SCOPe Domain Sequences for d3fi5b_:

Sequence; same for both SEQRES and ATOM records:

>d3fi5b_ d.2.1.3 (B:) Phage T4 lysozyme {Bacteriophage T4 [TaxId: 10665]}
mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrncngvitk
deaeklfnqdvdaavrgilrnaklkpvydsldavrwcalinmvfqmgetgvagftnslrm
lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayknl

Timeline for d3fi5b_:

• d3fi5b_ is new in SCOPe 2.03-stable
  
• d3fi5b_ appears in SCOPe 2.04
  
• d3fi5b_ appears in the current release, SCOPe 2.08