SCOPe 2.08: Domain d3fdxa1: 3fdx A:2-141

Lineage for d3fdxa1 (3fdx A:2-141)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families)
   share similar mode of ligand (Adenosine group) binding
   can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group

5. Family c.26.2.0: automated matches [191320] (1 protein)
   not a true family

6. Protein automated matches [190116] (28 species)
   not a true protein

7. Species Klebsiella pneumoniae [TaxId:272620] [193623] (2 PDB entries)

8. Domain d3fdxa1: 3fdx A:2-141 [199401]
   Other proteins in same PDB: d3fdxa2, d3fdxb2
   automated match to d3fdxb_
   complexed with atp, fmt, mg

Details for d3fdxa1

PDB Entry: 3fdx, 1.58 Å

PDB Description: putative filament protein / universal stress protein f from klebsiella pneumoniae.

PDB Compounds: (A:) Putative filament protein / universal stress protein F

SCOPe Domain Sequences for d3fdxa1:

Sequence, based on SEQRES records:

>d3fdxa1 c.26.2.0 (A:2-141) automated matches {Klebsiella pneumoniae [TaxId: 272620]}
ilvpidisdkefteriishveseariddaevhfltvipslpyyaslgmaytaelpgmdel
regsetqlkeiakkfsipedrmhfhvaegspkdkilalakslpadlviiashrpdittyl
lgsnaaavvrhaecsvlvvr

Sequence, based on observed residues (ATOM records):

>d3fdxa1 c.26.2.0 (A:2-141) automated matches {Klebsiella pneumoniae [TaxId: 272620]}
ilvpidisdkefteriishveseariddaevhfltvipsgmdelregsetqlkeiakkfs
ipedrmhfhvaegspkdkilalakslpadlviiashrpdittyllgsnaaavvrhaecsv
lvvr

Timeline for d3fdxa1:

• d3fdxa1 first appeared in SCOPe 2.03, called d3fdxa_
  
• d3fdxa1 appears in SCOPe 2.07