Lineage for d3fc6d_ (3fc6 D:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2728284Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2728285Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2728286Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 2729635Protein automated matches [190059] (14 species)
    not a true protein
  7. 2729930Species Mouse (Mus musculus) [TaxId:10090] [189464] (4 PDB entries)
  8. 2729935Domain d3fc6d_: 3fc6 D: [199400]
    Other proteins in same PDB: d3fc6a_, d3fc6c_
    automated match to d1upva_
    complexed with lx2, rea

Details for d3fc6d_

PDB Entry: 3fc6 (more details), 2.06 Å

PDB Description: hRXRalpha & mLXRalpha with an indole Pharmacophore, SB786875
PDB Compounds: (D:) Nr1h3 protein

SCOPe Domain Sequences for d3fc6d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fc6d_ a.123.1.1 (D:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qlspeqlgmieklvaaqqqcnrrsfsdrlrvtpwpiapdpqsrearqqrfahftelaivs
vqeivdfakqlpgflqlsredqiallktsaievmlletsrrynpgsesitflkdfsynre
dfakaglqvefinpifefsramnelqlndaefalliaisifsadrpnvqdqlqverlqht
yvealhayvsinhphdplmfprmlmklvslrtlssvhseqvfalrlqdkklppllseiwd
v

SCOPe Domain Coordinates for d3fc6d_:

Click to download the PDB-style file with coordinates for d3fc6d_.
(The format of our PDB-style files is described here.)

Timeline for d3fc6d_: